Aboutyourenglish.com

Search Preview

Effective writing for College & Work | www.AboutYourEnglish.com

www.aboutyourenglish.com/

Start here to write well for college and work. | Fix your English. | Say it in writing. | Pages and pages of examples.

Most Used Html Elements

  • <p> : 56
  • <a> : 45
  • <span> : 42
  • <div> : 30
  • <br> : 16
  • <img> : 12
  • <em> : 12
  • <li> : 9
  • <h2> : 8
  • <meta> : 7
  • <h4> : 7
  • <script> : 5
  • <ul> : 2
  • <link> : 2

Most Used Html Classes

  • "linkgrey" : 30
  • "special" : 29
  • "classgray" : 14
  • "classred" : 13
  • "classolive" : 12
  • "toggle" : 2
  • "hiddendiv" : 2

Where is www.aboutyourenglish.com hosted?

Country:
United States
City:
Scottsdale
Registrar:
Wild West Domains, LLC
Latitude:
33.61
Longitude:
-111.89
IP address:
97.74.215.85
IP Binary address:
1100001010010101101011101010101
IP Octal address:
14122553525
IP Hexadecimal address:
614ad755

Context analysis of aboutyourenglish.com

Number of letters on this page:
2 037
Number of words on this page:
375
Number of sentences on this page:
39
Average words per sentences on this page:
10
Number of syllables on this page:
639

Domain name architecture

Domain name length:
20
Hyphens:
Domain doesn't contain hyphens!
Domain name with Hindi letters:
अ (b) ओ उ ट ग़ ओ उ र ए ञ ग ल इ स (h) . च ओ म
Domain name with Hebrew letters:
(a) בּ (ο) (u) ת י (ο) (u) ר (e) נ ג ל (i) שׂ ה . ק(c) (ο) מ
Domain name with Cyrillic letters:
a б о у т y о у р e н г л и с х . ц о м
Domain name with Arabic letters:
ا ب (o) (u) ت ي (o) (u) ر (e) ن غ ل (i) ص ح . (c) (o) م
Domain name with Greek letters:
α ο υ τ y ο υ ρ ε ν γ λ ι σ (h) . χ ο μ
Domain name with Chinese letters:
诶 比 哦 伊吾 提 吾艾 哦 伊吾 艾儿 伊 艾娜 吉 艾勒 艾 艾丝 艾尺 . 西 哦 艾马
Domain without Consonants:
btyrnglsh.cm
Domain without Vowels:
aouyouei.o
Alphabet positions:
a1 b2 o15 u21 t20 y25 o15 u21 r18 e5 n14 g7 l12 i9 s19 h8 . c3 o15 m13
Domain name pattern:
V: Vowel, C: Consonant, N: Number
V C V V C C V V C V C C C V C C . C V C

<HEAD> DATA INFORMATION

Encoding:
UTF-8
robots:
noimageindex
keywords:
college writing, essays for college, essays for high school, developmental English, workplace writing, common errors in English, correcting grammar, common grammar mistakes, how to write well, common writing challenges, improve writing, writing an essay, fixing writing errors, writing tutorials, grammar tips
description:
Start here to write well for college and work. | Fix your English. | Say it in writing. | Pages and pages of examples.
google-site-verification:
hWxVLaTZmbgQ1g0--RUI1w9wqBXQ7P5Y_Dqzv7Asmvg
viewport:
width=device-width, initial-scale=1

Internal links in aboutyourenglish.com

  • index.html
  • new.html
  • contact.html
  • blog.html
  • strongerwritingskills/strongwriting.html
  • expressiteffectively/expressitapology.html
  • strongerwritingskills/strongerwritingskillssample.html
  • talktotheworld/talktotheworldsample.html
  • quickfix/quickfixcommonlyconfused.html
  • tutorials/Tutorial.html
  • strongerwritingskills/strongwritingsampleunitthree.html
  • #
  • businesswriting/businessformatletter.html
  • businesswriting/businessdirectmail.html
  • businesswriting/businessminutes.html
  • businesswriting/businessmemoreport.html
  • businesswriting/businesscoverletter.html
  • businesswriting/businessresume.html
  • businesswriting/businessfollowup.html
  • academicwriting/academicparagraphtoessay.html
  • academicwriting/academicintroductiontowriting2.html
  • academicwriting/academicoutlines2.html
  • academicwriting/academicstylemanuals.html
  • academicwriting/academicworkscited.html
  • academicwriting/academicwritingpatterns.html
  • academicwriting/academicwritingprocess.html
  • academicwriting/academicassessone.html
  • academicwriting/academicassesstwo.html
  • academicwriting/academicassessthree.html
  • academicwriting/academicassessfour.html
  • academicwriting/academiccommas.html
  • academicwriting/academicpartsofspeech.html
  • academicwriting/academicsubjunctive.html
  • academicwriting/academicverbals.html
  • academicwriting/academicverbs.html
  • academicwriting/academicverbtense.html
  • academicwriting/academicappeal.html
  • academicwriting/academicpersonalessay.html
  • academicwriting/academictomorrowsenglish.html
  • academicwriting/academicwhatisasentence.html
  • academicwriting/academicwhatisgrammar2.html
  • academicwriting/academicwritingvsspeaking.html

Possible email addresses for aboutyourenglish.com

  • info@aboutyourenglish.com
  • email@aboutyourenglish.com
  • support@aboutyourenglish.com
  • contact@aboutyourenglish.com
  • admin@aboutyourenglish.com
  • postmaster@aboutyourenglish.com
  • hostmaster@aboutyourenglish.com
  • domain@aboutyourenglish.com
  • abuse@aboutyourenglish.com

Possible Domain Typos

www.boutyourenglish.com, www.aqboutyourenglish.com, www.qboutyourenglish.com, www.awboutyourenglish.com, www.wboutyourenglish.com, www.azboutyourenglish.com, www.zboutyourenglish.com, www.axboutyourenglish.com, www.xboutyourenglish.com, www.asboutyourenglish.com, www.sboutyourenglish.com, www.aoutyourenglish.com, www.abvoutyourenglish.com, www.avoutyourenglish.com, www.abfoutyourenglish.com, www.afoutyourenglish.com, www.abgoutyourenglish.com, www.agoutyourenglish.com, www.abhoutyourenglish.com, www.ahoutyourenglish.com, www.abnoutyourenglish.com, www.anoutyourenglish.com, www.ab outyourenglish.com, www.a outyourenglish.com, www.abutyourenglish.com, www.aboiutyourenglish.com, www.abiutyourenglish.com, www.abokutyourenglish.com, www.abkutyourenglish.com, www.abolutyourenglish.com, www.ablutyourenglish.com, www.aboputyourenglish.com, www.abputyourenglish.com, www.abo9utyourenglish.com, www.ab9utyourenglish.com, www.abo0utyourenglish.com, www.ab0utyourenglish.com, www.abotyourenglish.com, www.abouytyourenglish.com, www.aboytyourenglish.com, www.abouhtyourenglish.com, www.abohtyourenglish.com, www.aboujtyourenglish.com, www.abojtyourenglish.com, www.abouktyourenglish.com, www.aboktyourenglish.com, www.abouityourenglish.com, www.aboityourenglish.com, www.abou7tyourenglish.com, www.abo7tyourenglish.com, www.abou8tyourenglish.com, www.abo8tyourenglish.com, www.abouyourenglish.com, www.aboutryourenglish.com, www.abouryourenglish.com, www.aboutfyourenglish.com, www.aboufyourenglish.com, www.aboutgyourenglish.com, www.abougyourenglish.com, www.abouthyourenglish.com, www.abouhyourenglish.com, www.aboutyyourenglish.com, www.abouyyourenglish.com, www.about5yourenglish.com, www.abou5yourenglish.com, www.about6yourenglish.com, www.abou6yourenglish.com, www.aboutourenglish.com, www.aboutytourenglish.com, www.abouttourenglish.com, www.aboutygourenglish.com, www.aboutgourenglish.com, www.aboutyhourenglish.com, www.abouthourenglish.com, www.aboutyjourenglish.com, www.aboutjourenglish.com, www.aboutyuourenglish.com, www.aboutuourenglish.com, www.aboutyurenglish.com, www.aboutyoiurenglish.com, www.aboutyiurenglish.com, www.aboutyokurenglish.com, www.aboutykurenglish.com, www.aboutyolurenglish.com, www.aboutylurenglish.com, www.aboutyopurenglish.com, www.aboutypurenglish.com, www.aboutyo9urenglish.com, www.abouty9urenglish.com, www.aboutyo0urenglish.com, www.abouty0urenglish.com, www.aboutyorenglish.com, www.aboutyouyrenglish.com, www.aboutyoyrenglish.com, www.aboutyouhrenglish.com, www.aboutyohrenglish.com, www.aboutyoujrenglish.com, www.aboutyojrenglish.com, www.aboutyoukrenglish.com, www.aboutyokrenglish.com, www.aboutyouirenglish.com, www.aboutyoirenglish.com, www.aboutyou7renglish.com, www.aboutyo7renglish.com, www.aboutyou8renglish.com, www.aboutyo8renglish.com, www.aboutyouenglish.com, www.aboutyoureenglish.com, www.aboutyoueenglish.com, www.aboutyourdenglish.com, www.aboutyoudenglish.com, www.aboutyourfenglish.com, www.aboutyoufenglish.com, www.aboutyourgenglish.com, www.aboutyougenglish.com, www.aboutyour4,english.com, www.aboutyou4,english.com, www.aboutyourtenglish.com, www.aboutyoutenglish.com, www.aboutyour5english.com, www.aboutyou5english.com, www.aboutyournglish.com, www.aboutyourewnglish.com, www.aboutyourwnglish.com, www.aboutyouresnglish.com, www.aboutyoursnglish.com, www.aboutyourednglish.com, www.aboutyourdnglish.com, www.aboutyourefnglish.com, www.aboutyourfnglish.com, www.aboutyourernglish.com, www.aboutyourrnglish.com, www.aboutyoure3nglish.com, www.aboutyour3nglish.com, www.aboutyoure4nglish.com, www.aboutyour4nglish.com, www.aboutyoureglish.com, www.aboutyourenbglish.com, www.aboutyourebglish.com, www.aboutyourengglish.com, www.aboutyouregglish.com, www.aboutyourenhglish.com, www.aboutyourehglish.com, www.aboutyourenjglish.com, www.aboutyourejglish.com, www.aboutyourenmglish.com, www.aboutyouremglish.com, www.aboutyouren glish.com, www.aboutyoure glish.com, www.aboutyourenlish.com, www.aboutyourengrlish.com, www.aboutyourenrlish.com, www.aboutyourengflish.com, www.aboutyourenflish.com, www.aboutyourengvlish.com, www.aboutyourenvlish.com, www.aboutyourengtlish.com, www.aboutyourentlish.com, www.aboutyourengblish.com, www.aboutyourenblish.com, www.aboutyourengylish.com, www.aboutyourenylish.com, www.aboutyourenghlish.com, www.aboutyourenhlish.com, www.aboutyourengnlish.com, www.aboutyourennlish.com,

More Sites

Stynson LLC
Number of used Technologies: 16
Number of used Javascript files: 16
Server Software: Apache
Server Location: United States / Scottsdale - 173.201.98.128
List of used Technologies: Wordpress CMS, Google Analytics, CSS (Cascading Style Sheets), Flexslider, Font Awesome, Google Font API, Html (HyperText Markup Language), Html5, Javascript, jQuery, jQuery Cookie, Php (Hypertext Preprocessor), Pingback, SuperFish
Instant Approval Cash Loans Fast Solution To All Your Credit Problem Short Term Loans No Guarantor Emergency cash advance Remarkable financial plan to help you! Get Cash Advance Help Effectively Mortgage Payday Texas.
Number of used Technologies: 4
Number of used Javascript files: 4
Server Software: LiteSpeed
Server Location: United States / Chicago - 198.20.92.28
List of used Technologies: AJAX Libraries API, CSS (Cascading Style Sheets), Html (HyperText Markup Language), Html5, Javascript, Php (Hypertext Preprocessor)
the Capital Link is an independent boutique providing advice on all aspects related to Mergers & Acquisitions (M&A), corporate finance and financial & strategic advisory.
Number of used Technologies: 6
Number of used Javascript files: 6
Server Software: Apache
Server Location: Belgium / - 188.93.153.73
List of used Technologies: Wordpress CMS, Google Analytics, CSS (Cascading Style Sheets), Google Font API, Html (HyperText Markup Language), Html5, Javascript, Php (Hypertext Preprocessor), Pingback, SVG (Scalable Vector Graphics), W3 Total cache
Домашний Телеком предоставляет широкополосный доступ к сети интернет, на скорости до 50 Мбит/сек, создали и развиваем внутригородскую сеть, построенную на базе оптоволоконных каналов и технологии ethernet. Для подключения не нужна телефонная линия или модем, каждый пользователь получает выделенный 50-мегабитный канал в свою квартиру
Number of used Technologies: 8
Number of used Javascript files: 8
Server Software: Apache/2.2.15 (CentOS)
Server Location: Ukraine / Energodar - 93.179.66.2
List of used Technologies: CSS (Cascading Style Sheets), Html (HyperText Markup Language), Javascript
Empresa dedicada a la distribución y a los servicios de neumáticos.
Number of used Technologies: 1
Number of used Javascript files: 1
Server Software: Apache/2.2.14 (Ubuntu)
Server Location: United Kingdom / - 217.182.12.129
List of used Technologies: Google Analytics, CSS (Cascading Style Sheets), Html (HyperText Markup Language), Javascript, Swf Object
Number of used Technologies: 18
Number of used Javascript files: 18
Server Software: cloudflare-nginx
Server Location: United States / San Francisco - 104.27.148.165
List of used Technologies: Wordpress CMS, Clicky Web Analytics, CSS (Cascading Style Sheets), Font Awesome, Google Font API, Html (HyperText Markup Language), Html5, Javascript, jQuery, Php (Hypertext Preprocessor), Pingback, SVG (Scalable Vector Graphics), BootstrapCDN, Maxcdn
Number of used Technologies: 5
Number of used Javascript files: 5
Server Software: Apache/2.2.22 (Debian)
Server Location: Czech Republic / - 91.239.201.150
List of used Technologies: CSS (Cascading Style Sheets), Html (HyperText Markup Language), Javascript, Php (Hypertext Preprocessor)
Two nights of Balkan music, dance & border-crossing celebration on January 13 and 14, 2017 in Brooklyn, NY
Number of used Technologies: 22
Number of used Javascript files: 22
Server Software: nginx/1.12.0
Server Location: United States / Provo - 69.89.31.56
List of used Technologies: Wordpress CMS, WordPress Stats, CSS (Cascading Style Sheets), Fancybox, Gravatar, Html (HyperText Markup Language), Iframe, Javascript, jQuery Cycle, Php (Hypertext Preprocessor), Pingback, SVG (Scalable Vector Graphics)
多元化音樂課程,名師匯萃,用心感受音樂帶來的喜悅 !
Number of used Technologies: 2
Number of used Javascript files: 2
Server Software: Pepyaka/1.11.3
Server Location: United States / Houston - 34.205.138.49
List of used Technologies: Wix.com - Free Website Builder, Html (HyperText Markup Language), Html5, Javascript, Php (Hypertext Preprocessor)
Number of used Technologies: 19
Number of used Javascript files: 19
Server Software: Apache
Server Location: Spain / - 95.130.53.210
List of used Technologies: Wordpress CMS, Google Analytics, CSS (Cascading Style Sheets), Html (HyperText Markup Language), Javascript, Php (Hypertext Preprocessor), Pingback, SVG (Scalable Vector Graphics)